PDB entry 1u6r

View 1u6r on RCSB PDB site
Description: Transition state analog complex of muscle creatine kinase (R134K) mutant
Class: transferase
Keywords: creatine kinase, transferase
Deposited on 2004-07-30, released 2005-08-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.167
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Creatine kinase, M chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CKM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00563 (0-379)
      • engineered (133)
    Domains in SCOPe 2.03: d1u6ra1, d1u6ra2
  • Chain 'B':
    Compound: Creatine kinase, M chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CKM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00563 (0-379)
      • engineered (133)
    Domains in SCOPe 2.03: d1u6rb1, d1u6rb2
  • Heterogens: MG, NO3, ADP, IOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6rA (A:)
    pfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgv
    dnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkptdkhktdlnhenlkggddl
    dphyvlssrvrtgksikgytlpphcsrgerraveklsvealnsltgefkgkyyplksmte
    qeqqqliddhflfdkpvsplllasgmardwpdargiwhndnksflvwvneedhlrvisme
    kggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvltcpsnlgtglrggvhvklah
    lskhpkfeeiltrlrlqkrgtggvdtaavgsvfdisnadrlgsseveqvqlvvdgvklmv
    emekklekgqsiddmipaqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6rB (B:)
    pfgnthnkyklnykseeeypdlskhnnhmakvltpdlykklrdketpsgftlddviqtgv
    dnpghpfimtvgcvagdeesytvfkdlfdpiiqdrhggfkptdkhktdlnhenlkggddl
    dphyvlssrvrtgksikgytlpphcsrgerraveklsvealnsltgefkgkyyplksmte
    qeqqqliddhflfdkpvsplllasgmardwpdargiwhndnksflvwvneedhlrvisme
    kggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvltcpsnlgtglrggvhvklah
    lskhpkfeeiltrlrlqkrgtggvdtaavgsvfdisnadrlgsseveqvqlvvdgvklmv
    emekklekgqsiddmipaqk