PDB entry 1u6f

View 1u6f on RCSB PDB site
Description: NMR solution structure of TcUBP1, a single RBD-unit from Trypanosoma cruzi
Class: RNA binding protein
Keywords: trypanosome, TcUBP1, mRNA-binding protein, GU-rich RNA, NMR structure, RNA BINDING PROTEIN
Deposited on 2004-07-29, released 2005-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein UBP1
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: Tcubp-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u6fa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u6fA (A:)
    msqiplvsqydpygqtaqlqqlqqqqqqhipptqmnpepdvlrnlmvnyipttvdevqlr
    qlferygpiesvkivcdretrqsrgygfvkfqsgssaqqaiaglngfnilnkrlkvalaa
    sghqrpgiagavgdgngyl