PDB entry 1u6a

View 1u6a on RCSB PDB site
Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
Class: immune system
Keywords: IMMUNOGLOBULIN, FAB, F105, GP120, HIV, immune system
Deposited on 2004-07-29, released 2005-08-09
The last revision prior to the SCOP 1.75 freeze date was dated 2008-12-09, with a file datestamp of 2008-12-05.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: f105 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u6ah1, d1u6ah2
  • Chain 'L':
    Compound: f105 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U6A (0-End)
    Domains in SCOP 1.75: d1u6al1, d1u6al2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1u6aH (H:)
    qvqlqesgpglvkpsetlsltctvsggsisshywswirqspgkglqwigyiyysgstnys
    pslksrvtisvetaknqfslkltsmtaadtavyycargpvpavfygdyrldpwgqgtlvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6aH (H:)
    vqlqesgpglvkpsetlsltctvsggsisshywswirqspgkglqwigyiyysgstnysp
    slksrvtisvetaknqfslkltsmtaadtavyycargpvpavfygdyrldpwgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1u6aL (L:)
    eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u6aL (L:)
    eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge