PDB entry 1u5j

View 1u5j on RCSB PDB site
Description: Propionibacterium shermanii transcarboxylase 5S subunit, Met186Ile
Class: transferase
Keywords: TIM-barrel, carbamylated lysine, transcarboxylase, cobalt, TRANSFERASE
Deposited on 2004-07-27, released 2004-09-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcarboxylase 5S subunit
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Gene: 5S
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70AC7
      • modified residue (194)
      • engineered (196)
    Domains in SCOPe 2.05: d1u5ja1, d1u5ja2
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5jA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggatydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdiaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5jA (A:)
    reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
    cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
    rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
    kdiaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
    smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
    ksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnv
    mmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqs
    keaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea