PDB entry 1u5h

View 1u5h on RCSB PDB site
Description: Structure of Citrate Lyase beta subunit from Mycobacterium tuberculosis
Deposited on 2004-07-27, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.268
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u5ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5hA (A:)
    mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaeaqkpaarnalrdtpldper
    tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
    aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
    vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaasheklawarrvlaasrs
    ergafafegqmvdspvlthaetmlrrageatse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5hA (A:)
    mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaeaqkpaarnalrdtpldper
    tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
    aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
    vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaa