PDB entry 1u5h

View 1u5h on RCSB PDB site
Description: Structure of Citrate Lyase beta subunit from Mycobacterium tuberculosis
Class: lyase
Keywords: TIM barrel, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, lyase
Deposited on 2004-07-27, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.268
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citE
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2498c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06162 (0-End)
      • engineered (16)
      • engineered (19)
      • engineered (22)
      • engineered (221-222)
    Domains in SCOPe 2.07: d1u5ha_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u5hA (A:)
    mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaeaqkpaarnalrdtpldper
    tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
    aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
    vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaasheklawarrvlaasrs
    ergafafegqmvdspvlthaetmlrrageatse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u5hA (A:)
    mnlraagpgwlfcpadapeafaaaaaaadvvildledgvaeaqkpaarnalrdtpldper
    tvvrinaggtadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavca
    aeiaaadptvgmmwgaedliatlggsssrradgayrdvarhvrstillaasafgrlalda
    vhldildveglqeeardaaavgfdvtvcihpsqipvvrkayaa