PDB entry 1u4o

View 1u4o on RCSB PDB site
Description: Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedicarboxylic acid
Class: oxidoreductase
Keywords: Protein-ligand complex, OXIDOREDUCTASE
Deposited on 2004-07-26, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (0-314)
      • expression tag (315-317)
    Domains in SCOPe 2.07: d1u4oa1, d1u4oa2, d1u4oa3
  • Heterogens: NDD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u4oA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u4oA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftknrddllplnnkimieigghikkncpnafiivvtnpvd
    vmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllk
    ryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesy
    lkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetk
    rmkalahhh