PDB entry 1u4j

View 1u4j on RCSB PDB site
Description: Crystal structure of a carbohydrate induced dimer of group I phospholipase A2 from Bungarus caeruleus at 2.1 A resolution
Class: hydrolase
Keywords: Phospholipase A2, Homodimer, Bungarus caeruleus, Mannose, HYDROLASE
Deposited on 2004-07-26, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u4ja_
  • Chain 'B':
    Compound: Phospholipase A2 isoform 2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u4jb_
  • Heterogens: NA, CL, ACY, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4jA (A:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u4jB (B:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq