PDB entry 1u4j
View 1u4j on RCSB PDB site
Description: Crystal structure of a carbohydrate induced dimer of group I phospholipase A2 from Bungarus caeruleus at 2.1 A resolution
Class: hydrolase
Keywords: Phospholipase A2, Homodimer, Bungarus caeruleus, Mannose, HYDROLASE
Deposited on
2004-07-26, released
2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-04.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Phospholipase A2 isoform 2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1u4ja_ - Chain 'B':
Compound: Phospholipase A2 isoform 2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1u4jb_ - Heterogens: NA, CL, ACY, MAN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1u4jA (A:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1u4jB (B:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq