PDB entry 1u46

View 1u46 on RCSB PDB site
Description: Crystal Structure of the Unphosphorylated Kinase Domain of the Tyrosine Kinase ACK1
Class: transferase
Keywords: Tyrosine Kinase, TRANSFERASE
Deposited on 2004-07-23, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u46a_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u46b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u46A (A:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u46A (A:)
    ltcligekdlrlleklggvvrrgewdapsgktvsvavkcpeamddfirevnamhsldhrn
    lirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrf
    ihrdlaarnlllatrdlvkigdfglmralpqddhyvmvpfawcapeslktrtfshasdtw
    mfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkped
    rptfvalrdflleaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u46B (B:)
    gsagegplqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvls
    qpeamddfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfll
    gtlsryavqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvm
    qehrkvpfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidke
    gerlprpedcpqdiynvmvqcwahkpedrptfvalrdflleaqptdmraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u46B (B:)
    ltcligekdlrlleklggvvrrgewdapsgktvsvavkcmddfirevnamhsldhrnlir
    lygvvltppmkmvtelaplgslldrlrkhqgllgtlsryavqvaegmgyleskrfihrdl
    aarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfshasdt
    wmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpe
    drptfvalrdflleaqp