PDB entry 1u3r

View 1u3r on RCSB PDB site
Description: Crystal Structure of Estrogen Receptor beta complexed with WAY-338
Class: transcription
Keywords: Estrogen Receptor, Estrogen Receptor Beta, ER-beta, ER, Estrogen, Nuclear Receptor, Transcription Factor, Agonist
Deposited on 2004-07-22, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: HOMO SAPIENS
    Gene: ESR2, NR3A2, ESTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u3ra1
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: HOMO SAPIENS
    Gene: ESR2, NR3A2, ESTRB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1u3rb1
  • Chain 'C':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
  • Heterogens: 338, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3rA (A:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3rA (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmqdadssrklahllnavtdalvwviaksgissq
    qqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u3rB (B:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3rB (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssssrklahllnavtdalvwviaksgissqqqsmr
    lanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.