PDB entry 1u3e

View 1u3e on RCSB PDB site
Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI
Deposited on 2004-07-21, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3eM (M:)
    mewkdikgyeghyqvsntgevysiksgktlkhqipkdgyhriglfkggkgktfqvhrlva
    ihfcegyeeglvvdhkdgnkdnnlstnlrwvtqkinvenqmsrgtlnvskaqqiakiknq
    kpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkgytfryklng