PDB entry 1u2w

View 1u2w on RCSB PDB site
Description: Crystal Structure of the Staphylococcus aureus pI258 CadC
Class: DNA binding protein
Keywords: cadmium, lead, repressor, soft metal ion resistance, ArsR/SmtB family, DNA BINDING PROTEIN
Deposited on 2004-07-20, released 2005-07-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cadC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
    Domains in SCOPe 2.01: d1u2wa1
  • Chain 'B':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cadC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
    Domains in SCOPe 2.01: d1u2wb_
  • Chain 'C':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cadC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1u2wc_
  • Chain 'D':
    Compound: Cadmium efflux system accessory protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: cadC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20047
      • engineered (10)
    Domains in SCOPe 2.01: d1u2wd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2wA (A:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2wA (A:)
    gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
    anashhlrtlykqgvvnfrlalyslgdehirqimmialahkkevk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2wB (B:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2wB (B:)
    gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
    anashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2wC (C:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2wC (C:)
    vnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvtianashh
    lrtlykqgvvnfrkegklalyslgdehirqimmialah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u2wD (D:)
    mkkkdtceifgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvc
    dianilgvtianashhlrtlykqgvvnfrkegklalyslgdehirqimmialahkkevkv
    nv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2wD (D:)
    gydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvti
    anashhlrtlylyslgdehirqimmialahkkev