PDB entry 1u2r

View 1u2r on RCSB PDB site
Description:
Deposited on 2004-07-20, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2rA (A:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2rA (A:)
    aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
    msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
    tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
    qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
    dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
    kvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlml
    yvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgr
    fvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknand
    lpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkisppv
    vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
    ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
    mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqav
    ggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqafpqmvfdhwst
    lgsdpldptskageivlaarkrhgmkeevpgwqeyydkl