PDB entry 1u2h

View 1u2h on RCSB PDB site
Description: X-ray Structure of the N-terminally truncated human APEP-1
Class: contractile protein
Keywords: Structural Genomics, Ig-fold I-set, RGD motif, Homophilic Adhesion, Arterial Smooth Muscle Cells, Atherosclerosis, CONTRACTILE PROTEIN
Deposited on 2004-07-19, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.161
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aortic preferentially expressed protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: Arotic Preferentially Expressed Gene 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15772
  Domains in SCOPe 2.08: d1u2ha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1u2hA (A:)
  gskapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegg
  lcrlrilaaergdagfytckavneygarqcearlevrge
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1u2hA (A:)
  kapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegglc
  rlrilaaergdagfytckavneygarqcearlevrg