PDB entry 1u2f

View 1u2f on RCSB PDB site
Description: solution structure of the first RNA-binding domain of hu2af65
Class: RNA-binding protein
Keywords: SPLICING, U2 SNRNP, RBD, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA-BINDING PROTEIN
Deposited on 1999-05-26, released 1999-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (splicing factor u2af 65 kd subunit)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u2fA (A:)
    arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde
    ttqamafdgiifqgqslkirrphdyqplpg