PDB entry 1u2f

View 1u2f on RCSB PDB site
Description: solution structure of the first rna-binding domain of hu2af65
Deposited on 1999-05-26, released 1999-08-20
The last revision prior to the SCOP 1.63 freeze date was dated 1999-08-20, with a file datestamp of 1999-08-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1u2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u2fA (A:)
    arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde
    ttqamafdgiifqgqslkirrphdyqplpg