PDB entry 1u2e

View 1u2e on RCSB PDB site
Description: Crystal Structure of the C-C bond hydrolase MhpC
Class: hydrolase
Keywords: alpha/beta hydrolase fold
Deposited on 2004-07-19, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: mhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2ea_
  • Chain 'B':
    Compound: 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: mhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2eb_
  • Chain 'C':
    Compound: 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: mhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2ec_
  • Chain 'D':
    Compound: 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: mhpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2ed_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2eA (A:)
    mmsyqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnid
    plveagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghs
    svaftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvf
    dtsdltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrnd
    rfvpmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2eA (A:)
    yqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplv
    eagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssva
    ftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdts
    dltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfv
    pmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2eB (B:)
    mmsyqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnid
    plveagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghs
    svaftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvf
    dtsdltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrnd
    rfvpmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2eB (B:)
    yqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplv
    eagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssva
    ftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdts
    dltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfv
    pmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2eC (C:)
    mmsyqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnid
    plveagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghs
    svaftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvf
    dtsdltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrnd
    rfvpmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2eC (C:)
    yqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplv
    eagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssva
    ftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdts
    dltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfv
    pmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u2eD (D:)
    mmsyqpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnid
    plveagyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghs
    svaftlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvf
    dtsdltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrnd
    rfvpmdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2eD (D:)
    qpqteaatsrflnveeagktlrihfndcgqgdetvvllhgsgpgatgwanfsrnidplve
    agyrvilldcpgwgksdsvvnsgsrsdlnarilksvvdqldiakihllgnsmgghssvaf
    tlkwpervgklvlmgggtggmslftpmptegikrlnqlyrqptienlklmmdifvfdtsd
    ltdalfearlnnmlsrrdhlenfvksleanpkqfpdfgprlaeikaqtlivwgrndrfvp
    mdaglrllsgiagselhifrdcghwaqwehadafnqlvlnflarp