PDB entry 1u0v

View 1u0v on RCSB PDB site
Description: An Aldol Switch Discovered in Stilbene Synthases Mediates Cyclization of Specificity of Type III Polyketide Synthases: 18xCHS structure
Class: transferase
Keywords: type III polyketide synthase, PKS, condensing enzyme, thiolase fold, alpha-beta-alpha-beta-alpha fold, aldol switch, catalytic triad, engineered resveratrol synthase, TRANSFERASE
Deposited on 2004-07-14, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Gene: CHS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (Start-392)
      • engineered (99)
      • engineered (101-103)
      • engineered (134)
      • engineered (136-138)
      • engineered (140)
      • engineered (160-163)
      • engineered (165)
      • engineered (271-273)
      • engineered (276)
    Domains in SCOPe 2.07: d1u0va1, d1u0va2
  • Chain 'B':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Gene: CHS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (Start-392)
      • engineered (99)
      • engineered (101-103)
      • engineered (134)
      • engineered (136-138)
      • engineered (140)
      • engineered (160-163)
      • engineered (165)
      • engineered (271-273)
      • engineered (276)
    Domains in SCOPe 2.07: d1u0vb1, d1u0vb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0vA (A:)
    gshgmvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekf
    qrmcdksmikrrymylteeilkenpnvceymapsldarqamlamevprlgkeaavkaike
    wgqpkskithlivcstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakd
    laennkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpi
    femvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisdyn
    sifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqn
    glkttgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0vA (A:)
    vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
    ksmikrrymylteeilkenpnvceymapsldarqamlamevprlgkeaavkaikewgqpk
    skithlivcstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakdlaenn
    kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvw
    taqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisdynsifwi
    ahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglktt
    geglewgvlfgfgpgltietvvlrsvai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0vB (B:)
    gshgmvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekf
    qrmcdksmikrrymylteeilkenpnvceymapsldarqamlamevprlgkeaavkaike
    wgqpkskithlivcstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakd
    laennkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpi
    femvwtaqtiapdsegaidghlreagltfhlkgavpdivsknitkalveafeplgisdyn
    sifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqn
    glkttgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0vB (B:)
    aqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdksmikrry
    mylteeilkenpnvceymapsldarqamlamevprlgkeaavkaikewgqpkskithliv
    cstttpdlpgadyqltkllglrpyvkrvgvfqhgcfaggtvlrlakdlaennkgarvlvv
    csevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvwtaqtiapd
    segaidghlreagltfhlkgavpdivsknitkalveafeplgisdynsifwiahpggpai
    ldqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkttgeglewgv
    lfgfgpgltietvvlrsvai