PDB entry 1u0u

View 1u0u on RCSB PDB site
Description: An Aldol Switch Discovered in Stilbene Synthases Mediates Cyclization Specificity of Type III Polyketide Synthases: Pine stilbene synthase structure
Class: transferase
Keywords: PKS, type III polyketide synthase, condensing enzyme, thiolase fold, alpha-beta-alpha-beta-alpha fold, aldol switch, catalytic triad, TRANSFERASE
Deposited on 2004-07-14, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ua1, d1u0ua2
  • Chain 'B':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ub1, d1u0ub2
  • Chain 'C':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0uc1, d1u0uc2
  • Chain 'D':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ud1, d1u0ud2
  • Chain 'E':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ue1, d1u0ue2
  • Chain 'F':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: PSS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0uf1, d1u0uf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0uA (A:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uA (A:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0uB (B:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uB (B:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u0uC (C:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uC (C:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u0uD (D:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uD (D:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u0uE (E:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uE (E:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u0uF (F:)
    gshgmggvdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkd
    kfkricersaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaeka
    iqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrm
    akdlaennrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqve
    kacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkis
    dwnklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkas
    lqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0uF (F:)
    dfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricer
    saikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsk
    sgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaenn
    rgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivw
    taqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwv
    vhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcstt
    geglemgvlfgfgpgltietvvlksvpiq