PDB entry 1u0o

View 1u0o on RCSB PDB site
Description: The mouse von Willebrand Factor A1-botrocetin complex
Class: blood clotting
Keywords: Rossmann fold, C-type lectin fold, Protein-protein complex, BLOOD CLOTTING
Deposited on 2004-07-14, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0oa_
  • Chain 'B':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ob_
  • Chain 'C':
    Compound: von willebrand factor
    Species: Mus musculus [TaxId:10090]
    Gene: VWF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0oc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0oA (A:)
    dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
    qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
    aqknpfvcksppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0oB (B:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
    cefqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u0oC (C:)
    dtpepplhnfycsklldlvflldgssmlseaefevlkafvvgmmerlhisqkrirvavve
    yhdgsraylelkarkrpselrritsqikytgsqvastsevlkytlfqifgkidrpeashi
    tllltasqepprmarnlvryvqglkkkkvivipvgigphaslkqirliekqapenkafll
    sgvdeleqrrdeivsylcdlapeapapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0oC (C:)
    fycsklldlvflldgssmlseaefevlkafvvgmmerlhisqkrirvavveyhdgsrayl
    elkarkrpselrritsqikytgsqvastsevlkytlfqifgkidrpeashitllltasqe
    pprmarnlvryvqglkkkkvivipvgigphaslkqirliekqapenkafllsgvdeleqr
    rdeivsylcdlapeap