PDB entry 1tzj

View 1tzj on RCSB PDB site
Description: Crystal Structure of 1-aminocyclopropane-1-carboxylate deaminase complexed with d-vinyl glycine
Class: hydrolase
Keywords: ACCD, substrate, PLP, Crystal, Complex, HYDROLASE
Deposited on 2004-07-10, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzja_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzjb_
  • Chain 'C':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzjc_
  • Chain 'D':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzjd_
  • Heterogens: SO4, PLP, A3B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzjA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzjA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelg
    fkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvg
    lerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvr
    ngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzjB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzjB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfkf
    dyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgler
    dimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrnge
    fpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tzjC (C:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tzjD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzjD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
    fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
    rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
    efpegsrvlyahlggvpalngysfifrdg