PDB entry 1tyz

View 1tyz on RCSB PDB site
Description: Crystal structure of 1-Aminocyclopropane-1-carboyxlate Deaminase from Pseudomonas
Class: hydrolase
Keywords: accd, complex, crystal, plp, inhibitor, hydrolase
Deposited on 2004-07-08, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyza_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyzb_
  • Chain 'C':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyzc_
  • Chain 'D':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pseudomonas sp. [TaxId:74568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyzd_
  • Heterogens: SO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tyzA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyzA (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelg
    fkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvg
    lerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvr
    ngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tyzB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyzB (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
    fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
    rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
    efpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyzC (C:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tyzD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyzD (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
    fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
    rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
    efpegsrvlyahlggvpalngysfifrdg