PDB entry 1tyq

View 1tyq on RCSB PDB site
Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
Class: structural protein
Keywords: structural protein
Deposited on 2004-07-08, released 2004-11-09
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-related protein 3
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tyqa1, d1tyqa2
  • Chain 'B':
    Compound: Actin-related Protein 2
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqb1
  • Chain 'C':
    Compound: Arp2/3 complex 41kDa subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqc_
  • Chain 'D':
    Compound: Arp2/3 complex 34kDa subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqd1, d1tyqd2
  • Chain 'E':
    Compound: Arp2/3 complex 21kDa subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqe_
  • Chain 'F':
    Compound: Arp2/3 complex 20kDa subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqf_
  • Chain 'G':
    Compound: Arp2/3 Complex 16kDa Subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1tyqg_
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tyqA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqA (A:)
    agrlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptya
    tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
    fnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipvaegyvigscikhi
    piagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgskwi
    kqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidvrr
    plyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelpkpidvqvithhmqryavwf
    ggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tyqB (B:)
    mdsqgrkvvvcdngtgfvkcgyagsnfpehifpalvgrpiirsttkvgnieikdlmvgde
    aselrsmlevnypmengivrnwddmkhlwdytfgpeklnidtrnckillteppmnptknr
    ekivevmfetyqfsgvyvaiqavltlyaqglltgvvvdsgdgvthicpvyegfslphltr
    rldiagrditrylikllllrgyafnhsadfetvrmikeklcyvgynieqeqklalettvl
    vesytlpdgriikvggerfeapealfqphlinvegvgvaellfntiqaadidtrsefykh
    ivlsggstmypglpsrlerelkqlylervlkgdveklskfkiriedpprrkhmvflggav
    ladimkdkdnfwmtrqeyqekgvrvleklgvtvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqB (B:)
    vltlyaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgy
    afnhsadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeap
    ealfqphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelk
    qlylervlkgdveklskfkiriedpprr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tyqC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvs
    qisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tyqD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplegdnigyitfvlfprhtnasardntinlihtfr
    dylhyhikcskayihtrmraktsdflkvlnrarp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tyqE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdkpskwwtcfvkrqfmnksls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tyqF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqF (F:)
    atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
    iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
    teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tyqG (G:)
    mskntvssarfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyqG (G:)
    frkvdvdeydenkfvdeagpdegevdsclrqgnmtaalqaalknppintksqavkdrags
    ivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaagg
    vgsivrvltarktv