PDB entry 1ty3

View 1ty3 on RCSB PDB site
Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Class: cell adhesion/immune system
Keywords: crystal structure; platelet integrin alphaIIBbeta3; fibrinogen binding; allostery; therapeutic antagonism, CELL ADHESION/IMMUNE SYSTEM COMPLEX
Deposited on 2004-07-06, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-09-02, with a file datestamp of 2008-08-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ty3a_
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ty3b4, d1ty3b5, d1ty3b6
  • Chain 'H':
    Compound: monoclonal antibody 10e5 heavy chain
    Species: Mus musculus [TaxId:10090]
  • Chain 'L':
    Compound: monoclonal antibody 10e5 light chain
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.06: d1ty3l3, d1ty3l4
  • Heterogens: NAG, NDG, CAC, MG, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ty3A (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ty3B (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ty3L (L:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec