PDB entry 1ty2

View 1ty2 on RCSB PDB site
Description: Crystal structure of the streptococcal pyrogenic exotoxin J (SPE-J)
Class: immune system
Keywords: Superantigen, T-cell receptor binding, mutagenesis, dimerization, crystal structure, zinc binding
Deposited on 2004-07-07, released 2004-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ty2a1, d1ty2a2
  • Chain 'B':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ty2b1, d1ty2b2
  • Chain 'C':
    Compound: putative exotoxin (superantigen)
    Species: Streptococcus pyogenes
    Gene: spe-j
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ty2c1, d1ty2c2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ty2A (A:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ty2B (B:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty2B (B:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnkivgnllidgvqqktlinpiki
    dkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatssstrs
    difkkykdnktinmkdfshfdiylwtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ty2C (C:)
    ksdsenikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyi
    ttkftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlin
    pikidkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatss
    strsdifkkykdnktinmkdfshfdiylwtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ty2C (C:)
    senikdvklqlnyayeiipvdytncnidyltthdfyidissykkknfsvdsevesyittk
    ftknqkvnifglpyiftrydvyyiyggvtpsvnsnsenskivgnllidgvqqktlinpik
    idkpiftiqefdfkirqylmqtykiydpnspyikgqleiaingnkhesfnlydatssstr
    sdifkkykdnktinmkdfshfdiylwtk