PDB entry 1txx

View 1txx on RCSB PDB site
Description: active-site variant of e.coli thioredoxin
Deposited on 1999-04-07, released 1999-09-13
The last revision prior to the SCOP 1.67 freeze date was dated 1999-09-13, with a file datestamp of 1999-09-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1txxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txxA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcvwckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla