PDB entry 1txx

View 1txx on RCSB PDB site
Description: active-site variant of e.coli thioredoxin
Class: oxidoreductase
Keywords: oxidoreductase, redox, cxxc
Deposited on 1999-04-07, released 1999-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (thioredoxin)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA25 (0-107)
    • engineered mutation (32-33)
  Domains in SCOPe 2.08: d1txxa_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1txxA (A:)
  sdkiihltddsfdtdvlkadgailvdfwaewcvwckmiapildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla