PDB entry 1txx

View 1txx on RCSB PDB site
Description: active-site variant of e.coli thioredoxin
Class: oxidoreductase
Keywords: oxidoreductase, redox, cxxc
Deposited on 1999-04-07, released 1999-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thioredoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • mutation (32-33)
    Domains in SCOPe 2.07: d1txxa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txxA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcvwckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla