PDB entry 1txw

View 1txw on RCSB PDB site
Description: photosynthetic reaction center blastochloris viridis (atcc)
Class: photosynthesis
Keywords: integral membrane protein; ubiquinone; secondary quinone (qb)
Deposited on 2004-07-06, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-03-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Rhodopseudomonas viridis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txwc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodopseudomonas viridis
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06008 (0-257)
      • modified residue (0)
    Domains in SCOPe 2.07: d1txwh1, d1txwh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodopseudomonas viridis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txwl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodopseudomonas viridis
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1txwm_
  • Heterogens: FE2, SO4, HEM, BCB, BPB, MQ9, UQ2, NS5, LDA, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txwC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txwH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txwL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txwM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk