PDB entry 1txv

View 1txv on RCSB PDB site
Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Deposited on 2004-07-06, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txvA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txvB (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txvH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
    dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1txvL (L:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec