PDB entry 1txo

View 1txo on RCSB PDB site
Description: Crystal structure of the Mycobacterium tuberculosis serine/threonine phosphatase PstP/Ppp at 1.95 A.
Class: hydrolase
Keywords: Putative Bacterial Enzyme, Serine/threonine protein phosphatases, PstP/Ppp, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, HYDROLASE
Deposited on 2004-07-05, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Bacterial Enzyme
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VKT2 (Start-236)
      • modified residue (36)
      • modified residue (86)
      • modified residue (93)
      • modified residue (159)
      • modified residue (173)
      • conflict (234-236)
    Domains in SCOPe 2.07: d1txoa_
  • Chain 'B':
    Compound: Putative Bacterial Enzyme
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VKT2 (Start-236)
      • modified residue (36)
      • modified residue (86)
      • modified residue (93)
      • modified residue (159)
      • modified residue (173)
      • conflict (234-236)
    Domains in SCOPe 2.07: d1txob_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txoA (A:)
    mtlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahlddd
    epggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyl
    lrdgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearag
    dryllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txoA (A:)
    lvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahldddep
    ggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyllr
    dgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearagdr
    yllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txoB (B:)
    mtlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahlddd
    epggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyl
    lrdgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearag
    dryllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txoB (B:)
    tlvlryaarsdrglvrannedsvyagarllaladgmgghaagevasqlviaalahlddde
    pggdllakldaavragnsaiaaqvemepdlegmgttltailfagnrlglvhigdsrgyll
    rdgeltqitkddtfvqtlvdegritpeeahshpqrslimraltgheveptltmrearagd
    ryllcsdglsdpvsdetilealqipevaesahrlielalrgggpdnvtvvvadleh