PDB entry 1txi

View 1txi on RCSB PDB site
Description: Crystal structure of the vdr ligand binding domain complexed to TX522
Class: gene regulation
Keywords: VDR ligand binding domain, TX522 complex, nuclear receptor, transcription regulation, alpha-helical sandwich, GENE REGULATION
Deposited on 2004-07-05, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1txia_
  • Heterogens: TX5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txiA (A:)
    gshmdslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsql
    smlphladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddm
    swtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrp
    gvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrcl
    sfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txiA (A:)
    lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
    adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
    qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
    lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
    smkltplvlevfg