PDB entry 1txc

View 1txc on RCSB PDB site
Description: Complex crystal structure of SPE16 with ANS
Class: plant protein
Keywords: seven antiparallel beta-sheet
Deposited on 2004-07-02, released 2005-10-25
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pathogenesis-related class 10 protein SPE-16
  Species: Pachyrhizus erosus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6T6J0 (0-146)
    • cloning artifact (147-156)
  Domains in SCOP 1.75: d1txca1
• Chain 'B':
  Compound: pathogenesis-related class 10 protein SPE-16
  Species: Pachyrhizus erosus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6T6J0 (0-146)
    • cloning artifact (147-156)
  Domains in SCOP 1.75: d1txcb1
• Heterogens: 2AN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1txcA (A:)
  gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
  dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
  tkgdaplsdavrddalakgagffkaiegyvlanpaey
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1txcB (B:)
  gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
  dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
  tkgdaplsdavrddalakgagffkaiegyvlanpaey