PDB entry 1tw9

View 1tw9 on RCSB PDB site
Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus
Class: transferase
Keywords: transferase
Deposited on 2004-06-30, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.181
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (119)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9a1, d1tw9a2, d1tw9a3
  • Chain 'B':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9b1, d1tw9b2, d1tw9b3
  • Chain 'C':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (119)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9c1, d1tw9c2, d1tw9c3
  • Chain 'D':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (119)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9d1, d1tw9d2, d1tw9d3
  • Chain 'E':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9e1, d1tw9e2, d1tw9e3
  • Chain 'F':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (107)
      • conflict (119)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9f1, d1tw9f2, d1tw9f3
  • Chain 'G':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9g1, d1tw9g2, d1tw9g3
  • Chain 'H':
    Compound: Glutathione S-transferase 2
    Species: Heligmosomoides polygyrus [TaxId:6339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NJQ6 (2-205)
      • cloning artifact (0-1)
      • conflict (20)
      • conflict (39)
      • conflict (90)
      • conflict (119)
      • conflict (139)
    Domains in SCOPe 2.06: d1tw9h1, d1tw9h2, d1tw9h3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tw9A (A:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9A (A:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemdkpktdvllpartkflgf
    itkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprik
    kwietrpetpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw9B (B:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9B (B:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktdvllpartkflgfitk
    flkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkwi
    etrpetpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tw9C (C:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9C (C:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyykpktdvllpartkf
    lgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtp
    rikkwietrpetpf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tw9D (D:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9D (D:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktydkpktdvllpartkf
    lgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtp
    rikkwietrpetpf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tw9E (E:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9E (E:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyyktdvllpartkfl
    gfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtpr
    ikkwietrpetpf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tw9F (F:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9F (F:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmgdvdkpk
    tdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpev
    kahmeriqqtprikkwietrpetpf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tw9G (G:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9G (G:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemkktdvllpartkflgfit
    kflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprikkw
    ietrpetpf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tw9H (H:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemktyyytalgfmtgdvdkp
    ktdvllpartkflgfitkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpe
    vkahmeriqqtprikkwietrpetpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw9H (H:)
    mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
    laqsqaicrylaktfgfagatpfesalidsladaytdyraemdkpktdvllpartkflgf
    itkflkknssgflvgdkiswvdllvaehvadmtnrvpeyiegfpevkahmeriqqtprik
    kwietrpetpf