PDB entry 1tw7

View 1tw7 on RCSB PDB site
Description: Wide Open 1.3A Structure of a Multi-drug Resistant HIV-1 Protease Represents a Novel Drug Target
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl protease, multi-drug resistance
Deposited on 2004-06-30, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.142
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1
    Database cross-references and differences (RAF-indexed):
    • GB AAP15109 (0-98)
      • engineered (9)
      • engineered (24)
      • engineered (35)
      • engineered (45)
      • engineered (53)
      • engineered (61-62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1tw7a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1
    Database cross-references and differences (RAF-indexed):
    • GB AAP15109 (0-98)
      • engineered (9)
      • engineered (24)
      • engineered (35)
      • engineered (45)
      • engineered (53)
      • engineered (61-62)
      • engineered (70)
      • engineered (81)
      • engineered (83)
      • engineered (89)
    Domains in SCOPe 2.07: d1tw7b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw7A (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tw7B (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf