PDB entry 1tvi

View 1tvi on RCSB PDB site
Description: Solution structure of TM1509 from Thermotoga maritima: VT1, a NESGC target protein
Class: structural genomics, unknown function
Keywords: alpha + beta, mixed 4-stranded beta sheet, four helix bundle, Structural Genomics, Protein Structure Initiative, NESGC, PSI, Northeast Structural Genomics Consortium
Deposited on 2004-06-29, released 2005-01-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0054 protein TM1509
    Species: Thermotoga maritima
    Gene: TM1509
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tvia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tviA (A:)
mgtshhhhhhssgrenlyfqghmirilgegkgskllenlkekleeivkkeigdvhvnvil
vsedeikelnqqfrgqdrptdvltfplmeedvygeiyvcpliveenarefnntfekelle
vvihgilhlagydhefedknskemfekqkkyveevwgewrsnpsedsdpgkr

    Sequence, based on observed residues (ATOM records): (download) 
    >1tviA (A:)
mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv
ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk
emfekqkkyveevwgewrsnpsedsdpgkr