PDB entry 1tvi

View 1tvi on RCSB PDB site
Description: solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein
Deposited on 2004-06-29, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tvia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tviA (A:)
    mgtshhhhhhssgrenlyfqghmirilgegkgskllenlkekleeivkkeigdvhvnvil
    vsedeikelnqqfrgqdrptdvltfplmeedvygeiyvcpliveenarefnntfekelle
    vvihgilhlagydhefedknskemfekqkkyveevwgewrsnpsedsdpgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tviA (A:)
    mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv
    ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk
    emfekqkkyveevwgewrsnpsedsdpgkr