PDB entry 1tui

View 1tui on RCSB PDB site
Description: intact elongation factor tu in complex with GDP
Class: elongation factor
Keywords: elongation factor, protein biosynthesis, GTP-binding
Deposited on 1996-05-23, released 1997-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tuia1, d1tuia2, d1tuia3
  • Chain 'B':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tuib1, d1tuib2, d1tuib3
  • Chain 'C':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tuic1, d1tuic2, d1tuic3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tuiA (A:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuiA (A:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tuiB (B:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuiB (B:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tuiC (C:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tuiC (C:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile