PDB entry 1tui

View 1tui on RCSB PDB site
Description:
Deposited on 1996-05-23, released 1997-06-05
The last revision prior to the SCOP 1.57 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuiA (A:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuiB (B:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuiC (C:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
    krgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreevergqvlakpg
    sitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile