PDB entry 1tuc

View 1tuc on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, circular permutant, cut at s19-p20
Deposited on 1996-02-29, released 1996-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.214
AEROSPACI score: -1.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1tuc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tuc_ (-)
    mgprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkldsgtgkelvlalydyq
    e