PDB entry 1tu9

View 1tu9 on RCSB PDB site
Description: Crystal Structure of a Protein PA3967, a Structurally Highly Homologous to a Human Hemoglobin, from Pseudomonas aeruginosa PAO1
Deposited on 2004-06-24, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.164
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tu9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tu9A (A:)
    ghmnaadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnl
    vmyargmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdv
    mgrgiaviksyygs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tu9A (A:)
    naadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmy
    argmsdsklralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgr
    giaviksyygs