PDB entry 1ttt

View 1ttt on RCSB PDB site
Description: Phe-tRNA, elongation factoR EF-TU:GDPNP ternary complex
Class: complex (elongation factor/tRNA)
Keywords: PROTEIN SYNTHESIS, EF-TU, TRNA, RIBOSOME, 1EFT, 4TNA, PEPTIDE ELONGATION RIBONUCLEOPROTEIN, COMPLEX (ELONGATION FACTOR-TRNA), COMPLEX (ELONGATION FACTOR-TRNA) complex
Deposited on 1995-11-16, released 1996-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: of elongation factor tu (ef-tu)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ttta1, d1ttta2, d1ttta3
  • Chain 'B':
    Compound: of elongation factor tu (ef-tu)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tttb1, d1tttb2, d1tttb3
  • Chain 'C':
    Compound: of elongation factor tu (ef-tu)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tttc1, d1tttc2, d1tttc3
  • Chain 'D':
    Compound: transfer ribonucleic acid (yeast, phe)
  • Chain 'E':
    Compound: transfer ribonucleic acid (yeast, phe)
  • Chain 'F':
    Compound: transfer ribonucleic acid (yeast, phe)
  • Heterogens: MG, PHE, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tttA (A:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tttB (B:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tttC (C:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.