PDB entry 1tt4

View 1tt4 on RCSB PDB site
Description: Structure of NP459575, a predicted glutathione synthase from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: NP459575, glutathione synthase, structural genomics, protein structure initiative, MCSG, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-06-21, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tt4a_
  • Chain 'B':
    Compound: putative cytoplasmic protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tt4b_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tt4A (A:)
    mhhhhhhssgvdlgtenlyfqsnamalndfhvsepytlgielemqvinppgydlsqdsst
    lidavkpqltageikhditesmlematgvcrdidqaaaqlsamqhvilqaasehhlgicg
    ggthpfqkwqrqevcdneryqrtlenfgyliqqatvfgqhvhvgcangddaiyllhglsh
    fvphfialsaaspymqgadtrfacarlnifsafpdngpmpwvsnwqefaglfrrlsyttm
    idsikdlhwdirpspafgtvevrvmdtpltldhainmagliqatahwllterpfkpqeqd
    yllykfnrfqacryglegvltdaytgdrrrladdtlrlldnvtpsarklgadsaidalrl
    qvkkggneaqymrefiadggsliglvqkhceiwagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tt4A (A:)
    dfhvsepytlgielemqvinppgydlsqdsstlidavkpqltageikhditesmlematg
    vcrdidqaaaqlsamqhvilqaasehhlgicgggthpfqkwrtlenfgyliqqatvfgqh
    vhvgcangddaiyllhglshfvphfialsaaspymqgadtrfacarlnifsafpdngpmp
    wvsnwqefaglfrrlsyttmidsikdlhwdirpspafgtvevrvmdtpltldhainmagl
    iqatahwllterpfkpqeqdyllykfnrfqacryglegvltdaytgdrrrladdtlrlld
    nvtpsarklgadsaidalrlqvkkggneaqymrefiadggsliglvqkhceiwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tt4B (B:)
    mhhhhhhssgvdlgtenlyfqsnamalndfhvsepytlgielemqvinppgydlsqdsst
    lidavkpqltageikhditesmlematgvcrdidqaaaqlsamqhvilqaasehhlgicg
    ggthpfqkwqrqevcdneryqrtlenfgyliqqatvfgqhvhvgcangddaiyllhglsh
    fvphfialsaaspymqgadtrfacarlnifsafpdngpmpwvsnwqefaglfrrlsyttm
    idsikdlhwdirpspafgtvevrvmdtpltldhainmagliqatahwllterpfkpqeqd
    yllykfnrfqacryglegvltdaytgdrrrladdtlrlldnvtpsarklgadsaidalrl
    qvkkggneaqymrefiadggsliglvqkhceiwagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tt4B (B:)
    dfhvsepytlgielemqvinppgydlsqdsstlidavkpqltageikhditesmlematg
    vcrdidqaaaqlsamqhvilqaasehhlgicgggthpfqkwrtlenfgyliqqatvfgqh
    vhvgcangddaiyllhglshfvphfialsaaspymqgadtrfacarlnifsafpdngpmp
    wvsnwqefaglfrrlsyttmidsikdlhwdirpspafgtvevrvmdtpltldhainmagl
    iqatahwllterpfkpqeqdyllykfnrfqacryglegvltdaytgdrrrladdtlrlld
    nvtpsarklgadsaidalrlqvkkggneaqymrefiadggsliglvqkhceiwa