PDB entry 1tsu

View 1tsu on RCSB PDB site
Description: crystal structure of decamer ncp1 substrate peptide in complex with wild-type d25n hiv-1 protease variant
Class: Viral protein/hydrolase
Keywords: CO-EVOLUTION, NUCLEOCAPDIS, SUBSTRATE RECOGNITION, HIV-1 PROTEASE, Viral protein-hydrolase COMPLEX
Deposited on 2004-06-21, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
    Domains in SCOPe 2.07: d1tsua1
  • Chain 'B':
    Compound: Pol polyprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (24)
    Domains in SCOPe 2.07: d1tsub1
  • Chain 'P':
    Compound: nc-p1 substrate peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsuA (A:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tsuB (B:)
    pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'P':
    No sequence available.