PDB entry 1ts4

View 1ts4 on RCSB PDB site
Description: q139k mutant of toxic shock syndrome toxin-1 from s. aureus
Deposited on 1997-10-10, released 1998-12-16
The last revision prior to the SCOP 1.57 freeze date was dated 1998-12-16, with a file datestamp of 1998-12-16.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.21
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts4A (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltkihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ts4B (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltkihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein