PDB entry 1trv

View 1trv on RCSB PDB site
Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Class: electron transport
Keywords: electron transport
Deposited on 1994-05-10, released 1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • conflict (61)
      • conflict (68)
      • conflict (72-73)
    Domains in SCOPe 2.08: d1trva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1trvA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv