PDB entry 1tru

View 1tru on RCSB PDB site
Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Class: electron transport
Keywords: electron transport
Deposited on 1994-05-10, released 1994-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
    • conflict (61)
    • conflict (68)
    • conflict (72-73)
  Domains in SCOPe 2.05: d1trua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1truA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv