PDB entry 1tqc

View 1tqc on RCSB PDB site
Description: Ovine recombinant PrP(114-234), ARR variant in complex with the VRQ14 Fab fragment (IgG2a)
Deposited on 2004-06-17, released 2004-07-06
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcA (A:)
    glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhdcvnit
    vkqhtvttttkgenftetdikimervveqmcitqyqresqay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnlvkqapgkgfewmgwintftgepty
    addfkgrfvfsldtsastaylqinnlknedtatyfftrgtdywgqgttltvssakttaps
    vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tqcC (C:)
    dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
    sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec