PDB entry 1tpy

View 1tpy on RCSB PDB site
Description: Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
Class: transferase
Keywords: Methyltransferase, cyclopropane synthase, mycolic acids, tuberculosis, SAM-dependent
Deposited on 2004-06-16, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methoxy mycolic acid synthase 2
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mmaA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tpya_
  • Heterogens: CO3, SAH, 16A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tpyA (A:)
    mvndltphfedvqahydlsddffrlfldptqtyscahferedmtleeaqiakidlalgkl
    glqpgmtlldigcgwgatmrraiaqydvnvvgltlsknqaahvqksfdemdtprdrrvll
    agweqfnepvdrivsigafehfghdrhadffarahkilppdgvlllhtitgltrqqmvdh
    glpltlwlarflkfiateifpggqpptiemveeqsaktgftltrrqslqphyartldlwa
    ealqehkseaiaiqseevyerymkyltgcaklfrvgyidvnqftlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpyA (A:)
    ndltphfedvqahydlsddffrlfldptqtyscahferedmtleeaqiakidlalgklgl
    qpgmtlldigcgwgatmrraiaqydvnvvgltlsknqaahvqksfdemdtprdrrvllag
    weqfnepvdrivsigafehfghdrhadffarahkilppdgvlllhtitgltrqqmvdhgl
    pltlwlarflkfiateifpggqpptiemveeqsaktgftltrrqslqphyartldlwaea
    lqehkseaiaiqseevyerymkyltgcaklfrvgyidvnqftlak