PDB entry 1tpx

View 1tpx on RCSB PDB site
Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody
Class: unknown function
Keywords: prion, antibody, UNKNOWN FUNCTION
Deposited on 2004-06-16, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.22
AEROSPACI score: -1.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Ovis aries [TaxId:9940]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpxa_
  • Chain 'B':
    Compound: the VRQ14 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TPX (0-211)
    Domains in SCOPe 2.07: d1tpxb1, d1tpxb2
  • Chain 'C':
    Compound: the VRQ14 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1TPX (0-218)
    Domains in SCOPe 2.07: d1tpxc1, d1tpxc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tpxA (A:)
    hvagaaaagavvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqys
    nqnnfvhdcvnitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrga
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpxA (A:)
    glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
    vkqhtvttttkgenftetdikimervveqmcitqyqresqay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpxB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnlvkqapgkgfewmgwintftgepty
    addfkgrfvfsldtsastaylqinnlknedtatyfftrgtdywgqgttltvssakttaps
    vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpxC (C:)
    dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
    sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec