PDB entry 1tpp

View 1tpp on RCSB PDB site
Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Deposited on 1982-09-27, released 1983-01-18
The last revision prior to the SCOP 1.71 freeze date was dated 1987-04-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.4 Å
R-factor: 0.191
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1tpp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tpp_ (-)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn